Deutsch
РусскийEnglish
EUR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 Artikel
Antike Gemälde Öl auf Leinwand Jesus um 1900
Antike Gemälde Öl auf Leinwand Jesus um 1900Antike Gemälde Öl auf Leinwand Jesus um 1900Antike Gemälde Öl auf Leinwand Jesus um 1900Antike Gemälde Öl auf Leinwand Jesus um 1900Antike Gemälde Öl auf Leinwand Jesus um 1900Antike Gemälde Öl auf Leinwand Jesus um 1900Antike Gemälde Öl auf Leinwand Jesus um 1900
Antike Gemälde Öl auf Leinwand Jesus um 1900
275,00 € inkl. MWSt.
Antike Gemälde Öl auf Leinwand auf Karton geklebt, Jesus um 1900 Professionell gereinigt und neu gefirnisst. Rahmen restauriert und neu beschichtet. 28cm x 35cm Blumenaufsatz ca. 20cm x 10cm Guten gebrauchten zustand
275,00 € inkl. MWSt.
Add to Cart
Product Code: eTZbF5
Product Condition: Neu
Einzelheiten
Produkt in den Korb
x

-------- oder --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i