Deutsch
РусскийEnglish
EUR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 Artikel
Wunderschöne antike Obstschale aus bunte Druckglass. ca. 1900 - 1930
Wunderschöne antike Obstschale aus bunte Druckglass. ca. 1900 - 1930Wunderschöne antike Obstschale aus bunte Druckglass. ca. 1900 - 1930Wunderschöne antike Obstschale aus bunte Druckglass. ca. 1900 - 1930Wunderschöne antike Obstschale aus bunte Druckglass. ca. 1900 - 1930Wunderschöne antike Obstschale aus bunte Druckglass. ca. 1900 - 1930Wunderschöne antike Obstschale aus bunte Druckglass. ca. 1900 - 1930Wunderschöne antike Obstschale aus bunte Druckglass. ca. 1900 - 1930Wunderschöne antike Obstschale aus bunte Druckglass. ca. 1900 - 1930Wunderschöne antike Obstschale aus bunte Druckglass. ca. 1900 - 1930Wunderschöne antike Obstschale aus bunte Druckglass. ca. 1900 - 1930
Wunderschöne antike Obstschale aus bunte Druckglass. ca. 1900 - 1930
Listenpreis 175,00 €
130,00 € inkl. MWSt.
Wunderschöne antike Obstschale aus bunte Druckglass. ca. 1900 - 1930 Werkstatt von Emile Galé??? 16cm x 8cm top gebrauchten zustand.
130,00 € inkl. MWSt.
Add to Cart
Product Code: 0Ue2gw
Product Condition: Neu
Einzelheiten
Produkt in den Korb
x

-------- oder --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i